Lineage for d4oevb_ (4oev B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626182Species Campylobacter jejuni [TaxId:192222] [259851] (2 PDB entries)
  8. 1626184Domain d4oevb_: 4oev B: [261115]
    automated match to d1xoca1
    complexed with gol, ni, oxl

Details for d4oevb_

PDB Entry: 4oev (more details), 1.9 Å

PDB Description: Crystal structure of NikZ from Campylobacter jejuni in complex with Ni(II) ion
PDB Compounds: (B:) Putative peptide ABC-transport system periplasmic peptide-binding protein

SCOPe Domain Sequences for d4oevb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oevb_ c.94.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
kipkdtliiaveneiarinpaysedhdavinlvfsgltrfdenmslkpdlakswdiskdg
lvydiflrddvlwhdgvkfsaddvkfsieafknpknnssiyvnfediksveilnpshvki
tlfkpypafldalsigmlpkhllenenlntssfnqnpigtgpykfvkwkkgeyvefkane
hfyldkvktprliikhifdpsiasaelkngkidaalidvsllnifkndenfgilreksad
yralmfnldneflkdlkvrqalnyavdkesivknllhdyafvanhplerswansknfkiy
kydpkkaedllvsagfkknkdgnfekdgkilefeiwamsndplrvslagilqsefrkigv
vskvvakpagsfdyskvdsfligwgspldpdfhtfrvfessqdsalndegwnfghyhdkk
vdialqkarntsnleerkkyykdfidalyenppfiflayldfalvynkdlkgiktrtlgh
hgvgftwnvyewsk

SCOPe Domain Coordinates for d4oevb_:

Click to download the PDB-style file with coordinates for d4oevb_.
(The format of our PDB-style files is described here.)

Timeline for d4oevb_: