SCOPe 2.08: Domain d4nzzb_: 4nzz B:

Lineage for d4nzzb_ (4nzz B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [236718] (4 PDB entries)

8. Domain d4nzzb_: 4nzz B: [261113]
   automated match to d4io0a_

Details for d4nzzb_

PDB Entry: 4nzz, 1.75 Å

PDB Description: Crystal structure of epoxide hydrolase from bacillus megaterium

PDB Compounds: (B:) Soluble epoxide hydrolase

SCOPe Domain Sequences for d4nzzb_:

Sequence; same for both SEQRES and ATOM records:

>d4nzzb_ c.69.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
mskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynl
sekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliaf
ngphpytfmrelrtnknqqkaseymkwfqkqevqdymerdnfsglrklvidpgvkkgylt
addvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdp
tfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk

Timeline for d4nzzb_:

• d4nzzb_ first appeared in SCOPe 2.04
  
• d4nzzb_ appears in SCOPe 2.07