SCOPe 2.07: Domain d4nqeh2: 4nqe H:117-239

Lineage for d4nqeh2 (4nqe H:117-239)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4nqeh2: 4nqe H:117-239 [261107]
   Other proteins in same PDB: d4nqea1, d4nqea3, d4nqeb_, d4nqec1, d4nqec2, d4nqed2, d4nqef_
   automated match to d2axhb2
   complexed with 2l4

Details for d4nqeh2

PDB Entry: 4nqe, 2.1 Å

PDB Description: crystal structure of tcr-mr1 ternary complex bound to 5-(2- oxoethylideneamino)-6-d-ribitylaminouracil

PDB Compounds: (H:) tcr beta

SCOPe Domain Sequences for d4nqeh2:

Sequence, based on SEQRES records:

>d4nqeh2 b.1.1.0 (H:117-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
sae

Sequence, based on observed residues (ATOM records):

>d4nqeh2 b.1.1.0 (H:117-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqrcqvqfyglsendewtqdrakpvtqivsae

Timeline for d4nqeh2:

• d4nqeh2 first appeared in SCOPe 2.04
  
• d4nqeh2 appears in SCOPe 2.06
  
• d4nqeh2 appears in the current release, SCOPe 2.08