SCOPe 2.04: Domain d4nqee1: 4nqe E:2-116

Lineage for d4nqee1 (4nqe E:2-116)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4nqee1: 4nqe E:2-116 [261104]
   Other proteins in same PDB: d4nqea1, d4nqec1, d4nqed2
   automated match to d2axhb1
   complexed with 2l4

Details for d4nqee1

PDB Entry: 4nqe, 2.1 Å

PDB Description: crystal structure of tcr-mr1 ternary complex bound to 5-(2- oxoethylideneamino)-6-d-ribitylaminouracil

PDB Compounds: (E:) tcr beta

SCOPe Domain Sequences for d4nqee1:

Sequence; same for both SEQRES and ATOM records:

>d4nqee1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4nqee1:

• d4nqee1 is new in SCOPe 2.04-stable
  
• d4nqee1 appears in SCOPe 2.05
  
• d4nqee1 appears in the current release, SCOPe 2.08