SCOPe 2.07: Domain d4nqec1: 4nqe C:1-178

Lineage for d4nqec1 (4nqe C:1-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)

8. Domain d4nqec1: 4nqe C:1-178 [261100]
   Other proteins in same PDB: d4nqea2, d4nqea3, d4nqeb_, d4nqec2, d4nqed1, d4nqed2, d4nqee1, d4nqee2, d4nqef_, d4nqeg1, d4nqeh1, d4nqeh2
   automated match to d4l4ta1
   complexed with 2l4

Details for d4nqec1

PDB Entry: 4nqe, 2.1 Å

PDB Description: crystal structure of tcr-mr1 ternary complex bound to 5-(2- oxoethylideneamino)-6-d-ribitylaminouracil

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4nqec1:

Sequence, based on SEQRES records:

>d4nqec1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records):

>d4nqec1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery
tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif
nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4nqec1:

• d4nqec1 first appeared in SCOPe 2.04
  
• d4nqec1 appears in SCOPe 2.06
  
• d4nqec1 appears in the current release, SCOPe 2.08