Lineage for d4nema_ (4nem A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1487141Protein automated matches [190501] (2 species)
    not a true protein
  7. 1487142Species Human (Homo sapiens) [TaxId:9606] [187448] (13 PDB entries)
  8. 1487149Domain d4nema_: 4nem A: [261094]
    automated match to d2erjd_
    complexed with 2jy

Details for d4nema_

PDB Entry: 4nem (more details), 1.93 Å

PDB Description: Small molecular fragment bound to crystal contact interface of Interleukin-2
PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d4nema_:

Sequence, based on SEQRES records: (download)

>d4nema_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfs
qsiistlt

Sequence, based on observed residues (ATOM records): (download)

>d4nema_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqdlisninvivlelkfmceyadetativeflnrwitfsqsiistlt

SCOPe Domain Coordinates for d4nema_:

Click to download the PDB-style file with coordinates for d4nema_.
(The format of our PDB-style files is described here.)

Timeline for d4nema_: