SCOPe 2.06: Domain d2mh7a1: 2mh7 A:0-94

Lineage for d2mh7a1 (2mh7 A:0-94)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (21 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [236409] (2 PDB entries)

8. Domain d2mh7a1: 2mh7 A:0-94 [261087]
   Other proteins in same PDB: d2mh7a2
   automated match to d4itka_
   complexed with fes

Details for d2mh7a1

PDB Entry: 2mh7

PDB Description: Solution structure of oxidized [2Fe-2S] ferredoxin PetF from Chlamydomonas reinhardtii

PDB Compounds: (A:) Ferredoxin, chloroplastic

SCOPe Domain Sequences for d2mh7a1:

Sequence; same for both SEQRES and ATOM records:

>d2mh7a1 d.15.4.0 (A:0-94) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
sflddaqmgngfvltcvayptsdctiqthqeealy

Timeline for d2mh7a1:

• d2mh7a1 first appeared in SCOPe 2.04, called d2mh7a_
  
• d2mh7a1 was called d2mh7a_ in SCOPe 2.05
  
• d2mh7a1 appears in SCOPe 2.07
  
• d2mh7a1 appears in the current release, SCOPe 2.08