SCOPe 2.06: Domain d3wyga_: 3wyg A:

Lineage for d3wyga_ (3wyg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [261066] (1 PDB entry)

8. Domain d3wyga_: 3wyg A: [261067]
   automated match to d2x19a_
   complexed with gtp, mg

Details for d3wyga_

PDB Entry: 3wyg, 2.15 Å

PDB Description: Crystal structure of Xpo1p-PKI-Gsp1p-GTP complex

PDB Compounds: (A:) Gsp1p

SCOPe Domain Sequences for d3wyga_:

Sequence; same for both SEQRES and ATOM records:

>d3wyga_ c.37.1.8 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 764097]}
vptfklvlvgdggtgkttfvkrhltgefekkyiatigvevhplsfytnfgeikfdvwdta
glekfgglrdgyyinaqcaiimfdvtsrityknvpnwhrdlvrvcenipivlcgnkvdvk
erkvkaktitfhrkknlqyydisaksnynfekpflwlarklagnpqlefv

Timeline for d3wyga_:

• d3wyga_ first appeared in SCOPe 2.04
  
• d3wyga_ appears in SCOPe 2.05
  
• d3wyga_ appears in SCOPe 2.07
  
• d3wyga_ appears in the current release, SCOPe 2.08