Lineage for d3wu3b_ (3wu3 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1637272Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF05362
  6. 1637273Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)
  7. 1637274Species Escherichia coli [TaxId:562] [102771] (6 PDB entries)
  8. 1637288Domain d3wu3b_: 3wu3 B: [261037]
    automated match to d1rrea_
    complexed with so4

Details for d3wu3b_

PDB Entry: 3wu3 (more details), 1.82 Å

PDB Description: reduced-form structure of e.coli lon proteolytic domain
PDB Compounds: (B:) Lon protease

SCOPe Domain Sequences for d3wu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu3b_ d.14.1.10 (B:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
vgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklgi
npdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqvl
pigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqne
p

SCOPe Domain Coordinates for d3wu3b_:

Click to download the PDB-style file with coordinates for d3wu3b_.
(The format of our PDB-style files is described here.)

Timeline for d3wu3b_: