SCOPe 2.04: Domain d4wt7b_: 4wt7 B:

Lineage for d4wt7b_ (4wt7 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (49 species)
   not a true protein

7. Species Agrobacterium vitis [TaxId:311402] [261009] (2 PDB entries)

8. Domain d4wt7b_: 4wt7 B: [261014]
   automated match to d3l49a_
   complexed with cl, x9x

Details for d4wt7b_

PDB Entry: 4wt7, 2 Å

PDB Description: Crystal structure of an ABC transporter solute binding protein (IPR025997) from Agrobacterium vitis (Avi_5165, Target EFI-511223) with bound allitol

PDB Compounds: (B:) ABC transporter substrate binding protein (Ribose)

SCOPe Domain Sequences for d4wt7b_:

Sequence; same for both SEQRES and ATOM records:

>d4wt7b_ c.93.1.0 (B:) automated matches {Agrobacterium vitis [TaxId: 311402]}
slkgkrigistagtdhffdlqaynaqiaevkrlggeplavdagrsdgklvaqlqtliaqk
pdaivqllgtltvidpwlkrardagipvltidvgsshslnnstsdnwgigkdlalqlvsd
iggegnvvvfngfygvtpcairydqlvnvikyfpkvkiiqpelrdvipntvqdafaqvta
ilnkypekgsikaiwsawdipqlgatqalaaagrteiktygvdgspevlqlvadpaspaa
advaqqpaelgrqaiqnvalllsgktlpresyvpallankqtvnevtrkl

Timeline for d4wt7b_:

• d4wt7b_ is new in SCOPe 2.04-stable
  
• d4wt7b_ appears in SCOPe 2.05
  
• d4wt7b_ appears in the current release, SCOPe 2.08