SCOPe 2.04: Domain d3wmsa3: 3wms A:529-615

Lineage for d3wmsa3 (3wms A:529-615)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Paenibacillus macerans [TaxId:44252] [256324] (2 PDB entries)

8. Domain d3wmsa3: 3wms A:529-615 [261012]
   Other proteins in same PDB: d3wmsa1, d3wmsa2, d3wmsa4
   automated match to d4jcla3
   complexed with ca; mutant

Details for d3wmsa3

PDB Entry: 3wms, 2.3 Å

PDB Description: The crystal structure of Y195I mutant alpha-cyclodextrin glycosyltransferase from Paenibacillus macerans

PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d3wmsa3:

Sequence; same for both SEQRES and ATOM records:

>d3wmsa3 b.1.18.0 (A:529-615) automated matches {Paenibacillus macerans [TaxId: 44252]}
tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv
aagktgvsvktssgtasntfksfnvlt

Timeline for d3wmsa3:

• d3wmsa3 is new in SCOPe 2.04-stable
  
• d3wmsa3 appears in SCOPe 2.05
  
• d3wmsa3 appears in the current release, SCOPe 2.08