Lineage for d3wmsa1 (3wms A:32-438)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095762Species Paenibacillus macerans [TaxId:44252] [256319] (2 PDB entries)
  8. 2095764Domain d3wmsa1: 3wms A:32-438 [261008]
    Other proteins in same PDB: d3wmsa2, d3wmsa3, d3wmsa4
    automated match to d4jcla1
    complexed with ca; mutant

Details for d3wmsa1

PDB Entry: 3wms (more details), 2.3 Å

PDB Description: The crystal structure of Y195I mutant alpha-cyclodextrin glycosyltransferase from Paenibacillus macerans
PDB Compounds: (A:) Alpha-cyclodextrin glucanotransferase

SCOPe Domain Sequences for d3wmsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmsa1 c.1.8.0 (A:32-438) automated matches {Paenibacillus macerans [TaxId: 44252]}
spdtsvdnkvnfstdviyqivtdrfadgdrtnnpagdafsgdrsnlklyfggdwqgiidk
indgyltgmgvtalwisqpvenitsvikysgvnntsyhgywardfkqtndafgdfadfqn
lidtahahnikvvidfapnhtspadrdnpgfaengalydngsllgaysndtaglfhhngg
tdfstiedgiyknlidladinhnnnamdayfksaidlwlgmgvdgirfdavkhmpfgwqk
sfvssiyggdhpvftfgewylgadqtdgdnikfanesgmnlldfeyaqevrevfrdktet
mkdlyevlastesqydyinnmvtfidnhdmdrfqvagsgtrateqalaltltsrgvpaiy
ygteqymtgdgdpnnrammtsfntgttaykviqalaplrksnpaiay

SCOPe Domain Coordinates for d3wmsa1:

Click to download the PDB-style file with coordinates for d3wmsa1.
(The format of our PDB-style files is described here.)

Timeline for d3wmsa1: