Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) not a true superfamily |
Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
Protein automated matches [254616] (4 species) not a true protein |
Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries) |
Domain d4wbae_: 4wba E: [260997] automated match to d2o1ja_ complexed with gol, po4; mutant |
PDB Entry: 4wba (more details), 1.8 Å
SCOPe Domain Sequences for d4wbae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wbae_ h.1.13.1 (E:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]} iekqmdrvvkemrrqlemidklttraieavellkriydkltv
Timeline for d4wbae_:
View in 3D Domains from other chains: (mouse over for more information) d4wbaa_, d4wbab_, d4wbac_, d4wbad_ |