SCOPe 2.04: Domain d4u0fa2: 4u0f A:148-219

Lineage for d4u0fa2 (4u0f A:148-219)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (6 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (2 PDB entries)

8. Domain d4u0fa2: 4u0f A:148-219 [260981]
   Other proteins in same PDB: d4u0fa1
   automated match to d2m8pa2
   complexed with 3a8, edo

Details for d4u0fa2

PDB Entry: 4u0f, 2.22 Å

PDB Description: hexameric hiv-1 ca in complex with bi-2

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4u0fa2:

Sequence, based on SEQRES records:

>d4u0fa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d4u0fa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraetllvqnanpdcktilkalgpgatleemmtacq

Timeline for d4u0fa2:

• d4u0fa2 is new in SCOPe 2.04-stable
  
• d4u0fa2 appears in SCOPe 2.05
  
• d4u0fa2 appears in the current release, SCOPe 2.08