SCOPe 2.04: Domain d4rlsb1: 4rls B:1-159

Lineage for d4rlsb1 (4rls B:1-159)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (7 PDB entries)

8. Domain d4rlsb1: 4rls B:1-159 [260966]
   Other proteins in same PDB: d4rlsa2, d4rlsb2, d4rlsc2, d4rlsd2
   automated match to d1i10a1
   complexed with 2op, 49c, nai, so4

Details for d4rlsb1

PDB Entry: 4rls, 1.91 Å

PDB Description: Lactate Dehydrogenase in complex with inhibitor compound 47

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4rlsb1:

Sequence, based on SEQRES records:

>d4rlsb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d4rlsb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarlnlvqrnvnifkfiipnvvkys
pnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4rlsb1:

• d4rlsb1 is new in SCOPe 2.04-stable
  
• d4rlsb1 appears in SCOPe 2.05
  
• d4rlsb1 appears in the current release, SCOPe 2.08