Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256346] (3 PDB entries) |
Domain d4qxka_: 4qxk A: [260950] automated match to d4ku8c_ complexed with dod, na, pcg |
PDB Entry: 4qxk (more details), 2.2 Å
SCOPe Domain Sequences for d4qxka_:
Sequence, based on SEQRES records: (download)
>d4qxka_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn vtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg lddvsnkay
>d4qxka_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn vtredspdpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhliggld dvsnkay
Timeline for d4qxka_: