Lineage for d4qxka_ (4qxk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1808270Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1808496Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 1808497Protein automated matches [226927] (11 species)
    not a true protein
  7. 1808517Species Human (Homo sapiens) [TaxId:9606] [256346] (3 PDB entries)
  8. 1808521Domain d4qxka_: 4qxk A: [260950]
    automated match to d4ku8c_
    complexed with dod, na, pcg

Details for d4qxka_

PDB Entry: 4qxk (more details), 2.2 Å

PDB Description: joint x-ray/neutron structure of pkgibeta in complex with cgmp
PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d4qxka_:

Sequence, based on SEQRES records: (download)

>d4qxka_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn
vtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg
lddvsnkay

Sequence, based on observed residues (ATOM records): (download)

>d4qxka_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn
vtredspdpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhliggld
dvsnkay

SCOPe Domain Coordinates for d4qxka_:

Click to download the PDB-style file with coordinates for d4qxka_.
(The format of our PDB-style files is described here.)

Timeline for d4qxka_: