Lineage for d4ndqa_ (4ndq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619438Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1619439Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1619577Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 1619578Protein automated matches [190728] (15 species)
    not a true protein
  7. 1619579Species Azotobacter vinelandii [TaxId:322710] [258948] (4 PDB entries)
  8. 1619582Domain d4ndqa_: 4ndq A: [260912]
    automated match to d2ogxa_
    complexed with 8m0, atp, m10, mg, mo

Details for d4ndqa_

PDB Entry: 4ndq (more details), 1.75 Å

PDB Description: crystal structure molybdenum storage protein with fully mo-loaded cavity
PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d4ndqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndqa_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
gvrpa

SCOPe Domain Coordinates for d4ndqa_:

Click to download the PDB-style file with coordinates for d4ndqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ndqa_: