SCOPe 2.06: Domain d4mtdb_: 4mtd B:

Lineage for d4mtdb_ (4mtd B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries)

8. Domain d4mtdb_: 4mtd B: [260906]
   automated match to d2fe3a_
   protein/DNA complex; complexed with zn

Details for d4mtdb_

PDB Entry: 4mtd, 2.5 Å

PDB Description: Zinc Uptake Regulator Complexed With Zinc AND DNA

PDB Compounds: (B:) Zinc uptake regulation protein

SCOPe Domain Sequences for d4mtdb_:

Sequence; same for both SEQRES and ATOM records:

>d4mtdb_ a.4.5.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ktttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakppt
vyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimh
tlaakmgfalrhnvieahglcaacveveac

Timeline for d4mtdb_:

• d4mtdb_ first appeared in SCOPe 2.04
  
• d4mtdb_ appears in SCOPe 2.05
  
• d4mtdb_ appears in SCOPe 2.07
  
• d4mtdb_ appears in the current release, SCOPe 2.08