Lineage for d4whxb_ (4whx B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018494Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 3018495Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 3018614Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 3018615Protein automated matches [190815] (21 species)
    not a true protein
  7. 3018639Species Burkholderia pseudomallei [TaxId:557724] [260287] (1 PDB entry)
  8. 3018641Domain d4whxb_: 4whx B: [260850]
    automated match to d3u0ga_
    complexed with ala, edo

Details for d4whxb_

PDB Entry: 4whx (more details), 2.05 Å

PDB Description: x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
PDB Compounds: (B:) Branched-chain-amino-acid transaminase

SCOPe Domain Sequences for d4whxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whxb_ e.17.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 557724]}
smadrdgkiwmdgkliewrdakihvlthtlhygmgvfegvrayktadggtaifrlkehtk
rllnsakifqmdvpfdqetleaaqrdvvrenklescylrpiiwigseklgvsakgntihv
aiaawpwgaylgeeglakgirvktssftrhhvnvsmvrakasgwyvnsilanqeatadgy
deallldvdgyvsegsgenfflvnrgklytpdlascldgitrdtvitlakeagieviekr
itrdevytadeafftgtaaevtpireldnrtigggargpiteklqsaffdvvngksakha
dwltki

SCOPe Domain Coordinates for d4whxb_:

Click to download the PDB-style file with coordinates for d4whxb_.
(The format of our PDB-style files is described here.)

Timeline for d4whxb_: