Lineage for d4wfxa_ (4wfx A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017732Protein automated matches [190260] (25 species)
    not a true protein
  7. 3017735Species Coxsackievirus b3 [TaxId:103903] [188493] (5 PDB entries)
  8. 3017738Domain d4wfxa_: 4wfx A: [260849]
    automated match to d4k4za_
    complexed with na; mutant

Details for d4wfxa_

PDB Entry: 4wfx (more details), 1.81 Å

PDB Description: coxsackievirus b3 polymerase - f232l mutant - nacl crystal form
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d4wfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wfxa_ e.8.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 103903]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghlialdysgydas
lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecfnevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

SCOPe Domain Coordinates for d4wfxa_:

Click to download the PDB-style file with coordinates for d4wfxa_.
(The format of our PDB-style files is described here.)

Timeline for d4wfxa_: