SCOPe 2.07: Domain d4w68b_: 4w68 B:

Lineage for d4w68b_ (4w68 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d4w68b_: 4w68 B: [260846]
   automated match to d4kfzd_
   complexed with so4

Details for d4w68b_

PDB Entry: 4w68, 2 Å

PDB Description: cytoplasmically produced homodimeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb)

PDB Compounds: (B:) Single Domain Antibody

SCOPe Domain Sequences for d4w68b_:

Sequence; same for both SEQRES and ATOM records:

>d4w68b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
mevqlvesggglvqagdslrlsatasgrtfsravmgwfrqapgkerefvaaisaapgtay
yafyadsvrgrfsisadsakntvylqmnslkpedtavyyvaadlkmqvaaymnqrsvdyw
gqgtqvtvss

Timeline for d4w68b_:

• d4w68b_ first appeared in SCOPe 2.04
  
• d4w68b_ appears in SCOPe 2.06
  
• d4w68b_ appears in the current release, SCOPe 2.08, called d4w68b1