Class a: All alpha proteins [46456] (285 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (25 species) not a true protein |
Species Homo sapiens [TaxId:9606] [260458] (1 PDB entry) |
Domain d4uy1b_: 4uy1 B: [260839] automated match to d1le6a_ complexed with 1pe, ca, dms, peg, tjm |
PDB Entry: 4uy1 (more details), 2.2 Å
SCOPe Domain Sequences for d4uy1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uy1b_ a.133.1.2 (B:) automated matches {Homo sapiens [TaxId: 9606]} gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp kcd
Timeline for d4uy1b_: