Lineage for d4uy1b_ (4uy1 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505317Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1505318Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1505323Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1505677Protein automated matches [190139] (25 species)
    not a true protein
  7. 1505761Species Homo sapiens [TaxId:9606] [260458] (1 PDB entry)
  8. 1505763Domain d4uy1b_: 4uy1 B: [260839]
    automated match to d1le6a_
    complexed with 1pe, ca, dms, peg, tjm

Details for d4uy1b_

PDB Entry: 4uy1 (more details), 2.2 Å

PDB Description: novel pyrazole series of group x secretory phospholipase a2 (spla2-x) inhibitors
PDB Compounds: (B:) group 10 secretory phospholipase a2

SCOPe Domain Sequences for d4uy1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uy1b_ a.133.1.2 (B:) automated matches {Homo sapiens [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

SCOPe Domain Coordinates for d4uy1b_:

Click to download the PDB-style file with coordinates for d4uy1b_.
(The format of our PDB-style files is described here.)

Timeline for d4uy1b_: