Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (36 species) not a true protein |
Species Clostridium perfringens [TaxId:195102] [260453] (3 PDB entries) |
Domain d4utub1: 4utu B:1-220 [260838] Other proteins in same PDB: d4utua2, d4utub2 automated match to d1yxya1 complexed with cl, lry |
PDB Entry: 4utu (more details), 1.45 Å
SCOPe Domain Sequences for d4utub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4utub1 c.1.2.0 (B:1-220) automated matches {Clostridium perfringens [TaxId: 195102]} mldvvkgnlivscqalsdeplhssfimgrmaiaakqggaaairaqgvndineikevtklp iigiiarnyddseiyitptmkevdellktdcemialdatkrkrpngenvkdlvdaihakg rlamadistleegieaeklgfdcvsttlsgytpyskqsnsvdfelleelvktvkipvice grintpeelkkaldlgaysavvggaitrpqqitkrftdil
Timeline for d4utub1: