SCOPe 2.07: Domain d4tz2a1: 4tz2 A:981-1108

Lineage for d4tz2a1 (4tz2 A:981-1108)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d4tz2a1: 4tz2 A:981-1108 [260818]
   Other proteins in same PDB: d4tz2a2
   automated match to d3daia_
   complexed with 39r, cl, so4, trs

Details for d4tz2a1

PDB Entry: 4tz2, 1.7 Å

PDB Description: fragment-based screening of the bromodomain of atad2

PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4tz2a1:

Sequence; same for both SEQRES and ATOM records:

>d4tz2a1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

Timeline for d4tz2a1:

• d4tz2a1 first appeared in SCOPe 2.04, called d4tz2a_
  
• d4tz2a1 appears in SCOPe 2.06
  
• d4tz2a1 appears in the current release, SCOPe 2.08