Lineage for d4u05a_ (4u05 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513029Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)
  8. 1513158Domain d4u05a_: 4u05 A: [260817]
    automated match to d4kfzd_
    complexed with so4

Details for d4u05a_

PDB Entry: 4u05 (more details), 2.5 Å

PDB Description: homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb) s74a variant
PDB Compounds: (A:) Single Domain Antibody

SCOPe Domain Sequences for d4u05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u05a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
yafyadsvrgrfsiaadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
gqgtqvtvss

SCOPe Domain Coordinates for d4u05a_:

Click to download the PDB-style file with coordinates for d4u05a_.
(The format of our PDB-style files is described here.)

Timeline for d4u05a_: