Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.0: automated matches [191553] (1 protein) not a true family |
Protein automated matches [190955] (7 species) not a true protein |
Species Peptoclostridium difficile [TaxId:272563] [260809] (1 PDB entry) |
Domain d4rn7a1: 4rn7 A:117-299 [260810] Other proteins in same PDB: d4rn7a2 automated match to d1jwqa_ complexed with epe, fmt, gol, zn |
PDB Entry: 4rn7 (more details), 1.72 Å
SCOPe Domain Sequences for d4rn7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rn7a1 c.56.5.0 (A:117-299) automated matches {Peptoclostridium difficile [TaxId: 272563]} ytvfidpghggndkgtesktsnryekdlnlqiakklanklskqkdiqvvvsrtddtyisl kdrailannssadvlvsihlnaekngntatgietwyrnkatdgskelaqtvqstivsyvk vrdrgivennfevlresnmpailiecgflttpseeqkiinekyqdqlaegivqgvlsyld skg
Timeline for d4rn7a1: