SCOPe 2.04: Domain d4rk5a_: 4rk5 A:

Lineage for d4rk5a_ (4rk5 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (49 species)
   not a true protein

7. Species Lactobacillus casei [TaxId:321967] [260805] (4 PDB entries)

8. Domain d4rk5a_: 4rk5 A: [260807]
   automated match to d2o20b_
   complexed with act, na, suc

Details for d4rk5a_

PDB Entry: 4rk5, 1.35 Å

PDB Description: crystal structure of laci family transcriptional regulator from lactobacillus casei, target efi-512911, with bound sucrose

PDB Compounds: (A:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d4rk5a_:

Sequence; same for both SEQRES and ATOM records:

>d4rk5a_ c.93.1.0 (A:) automated matches {Lactobacillus casei [TaxId: 321967]}
tgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkqlksreldg
vilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldylfnqghrr
fayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgkqlaslap
nvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplttvhqpvas
maaaathellkglgrqvaqdtqptlhlslkirqsa

Timeline for d4rk5a_:

• d4rk5a_ is new in SCOPe 2.04-stable
  
• d4rk5a_ appears in SCOPe 2.05
  
• d4rk5a_ appears in the current release, SCOPe 2.08