Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (49 species) not a true protein |
Species Enterococcus faecium [TaxId:333849] [260801] (1 PDB entry) |
Domain d4rk1f_: 4rk1 F: [260802] automated match to d3k9cb_ complexed with cl, rib |
PDB Entry: 4rk1 (more details), 1.9 Å
SCOPe Domain Sequences for d4rk1f_:
Sequence, based on SEQRES records: (download)
>d4rk1f_ c.93.1.0 (F:) automated matches {Enterococcus faecium [TaxId: 333849]} ktigvlvpditnpffstlmrgiedilykqnfvtilcnadsdhqkeieylaeltrrgvdgf iiatsavstdainenlkkqgrpfivldqkksegfsdavrtddfrggylagmhllslghqt ialvypenppenvhariegfksaldvyqiphdqlillptqfskqggyqitaelldsaatg vfalndelafglyrgleeagksipedysiigydnidmceyikpklttiaqpifelgqtsa kllldriqfpekeweekrlpvrfekrfstaplk
>d4rk1f_ c.93.1.0 (F:) automated matches {Enterococcus faecium [TaxId: 333849]} ktigvlvpditnpffstlmrgiedilykqnfvtilcnadsieylaeltrrgvdgfiiats avstdainenlkkqgrpfivldqkksegfsdavrtddfrggylagmhllslghqtialvy penppenvhariegfksaldvyqiphdqlillptqfskqggyqitaelldsaatgvfaln delafglyrgleeagksipedysiigydnidmceyikpklttiaqpifelgqtsakllld riqfpekeweekrlpvrfekrfstaplk
Timeline for d4rk1f_: