Lineage for d4rk0c_ (4rk0 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624830Species Enterococcus faecalis [TaxId:226185] [231906] (2 PDB entries)
  8. 1624833Domain d4rk0c_: 4rk0 C: [260793]
    automated match to d2o20b_
    complexed with rib

Details for d4rk0c_

PDB Entry: 4rk0 (more details), 1.8 Å

PDB Description: crystal structure of laci family transcriptional regulator from enterococcus faecalis v583, target efi-512923, with bound ribose
PDB Compounds: (C:) LacI family sugar-binding transcriptional regulator

SCOPe Domain Sequences for d4rk0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rk0c_ c.93.1.0 (C:) automated matches {Enterococcus faecalis [TaxId: 226185]}
sktigvivpditnpffaqlirgiesvlykenfililcnadqdvtreheyltelirrsvdg
fviasseisnqtinetlrakkipfivldqkkaegfsdavltddyrggqlaakhlqeqrhe
qvivvmpphapvniqqrlkgfcsvytekvqlietelsktggyqavpeilktestgifain
deiafglyrglaeagkkipedysiigydnvdmceyvspplttiaqpvfqlgqttatllle
rihqpakdweeqtlpvqlierfstaplk

SCOPe Domain Coordinates for d4rk0c_:

Click to download the PDB-style file with coordinates for d4rk0c_.
(The format of our PDB-style files is described here.)

Timeline for d4rk0c_: