Lineage for d4qzva2 (4qzv A:509-766)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617800Species Human (Homo sapiens) [TaxId:9606] [188340] (44 PDB entries)
  8. 1617885Domain d4qzva2: 4qzv A:509-766 [260769]
    Other proteins in same PDB: d4qzva1, d4qzvc1
    automated match to d4n8db2
    complexed with nag

Details for d4qzva2

PDB Entry: 4qzv (more details), 2.59 Å

PDB Description: bat-derived coronavirus hku4 uses mers-cov receptor human cd26 for cell entry
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4qzva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzva2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d4qzva2:

Click to download the PDB-style file with coordinates for d4qzva2.
(The format of our PDB-style files is described here.)

Timeline for d4qzva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qzva1