Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Rhizomucor miehei [TaxId:4839] [256971] (6 PDB entries) |
Domain d4qp0a_: 4qp0 A: [260759] automated match to d1qnra_ complexed with so4 |
PDB Entry: 4qp0 (more details), 2.3 Å
SCOPe Domain Sequences for d4qp0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qp0a_ c.1.8.0 (A:) automated matches {Rhizomucor miehei [TaxId: 4839]} sfvqtsgpqftldgkpfyfegtnayylmtsdqsnvkqvfsdmkslglpvvrtwlfnlgsd svwfqqwdsssnkmvindnsdtglgridyiiqqaasqdikliftlnnnwedyggmdyyvk nfggtyhddfytntemidsfkeyishvlnrensltgvkykddptifgweianeprcvgsg dfpassncsttvttawikeiseyiksidsnhlvavgdegffnrkgesdyeynggsgmdfd ailalssidfgtfhlypeawskgtdsswsvqwikdhaaaqadadkpvimeeyglstdalr vaqypvwqgtvededlaadafwqiavpcstmdgfgicasdndiattvtnhadamakk
Timeline for d4qp0a_: