SCOPe 2.04: Domain d4qo1b_: 4qo1 B:

Lineage for d4qo1b_ (4qo1 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (34 PDB entries)

8. Domain d4qo1b_: 4qo1 B: [260757]
   Other proteins in same PDB: d4qo1a_
   automated match to d2feja_
   protein/DNA complex; complexed with zn

Details for d4qo1b_

PDB Entry: 4qo1, 1.92 Å

PDB Description: p53 DNA binding domain in complex with Nb139

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4qo1b_:

Sequence; same for both SEQRES and ATOM records:

>d4qo1b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
vrvcacpgrdrrteeenlr

Timeline for d4qo1b_:

• d4qo1b_ is new in SCOPe 2.04-stable
  
• d4qo1b_ appears in SCOPe 2.05
  
• d4qo1b_ appears in the current release, SCOPe 2.08