Lineage for d4pp0b_ (4pp0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915217Species Agrobacterium tumefaciens [TaxId:176299] [260526] (10 PDB entries)
  8. 2915222Domain d4pp0b_: 4pp0 B: [260747]
    automated match to d1hsla_
    complexed with edo, op1, peg

Details for d4pp0b_

PDB Entry: 4pp0 (more details), 1.57 Å

PDB Description: structure of the pbp noct-m117n in complex with pyronopaline
PDB Compounds: (B:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d4pp0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pp0b_ c.94.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
rydaimaamgiqparekviafsrpylltpntflttadspllktqvaienlpldnitpeqk
aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
qklsqqwfgydaspk

SCOPe Domain Coordinates for d4pp0b_:

Click to download the PDB-style file with coordinates for d4pp0b_.
(The format of our PDB-style files is described here.)

Timeline for d4pp0b_: