Lineage for d4pnja_ (4pnj A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474672Protein Myoglobin [46469] (9 species)
  7. 1474793Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (239 PDB entries)
    Uniprot P02185
  8. 1474854Domain d4pnja_: 4pnj A: [260746]
    automated match to d1ufpa_
    complexed with hem, so4

Details for d4pnja_

PDB Entry: 4pnj (more details), 1.36 Å

PDB Description: recombinant sperm whale p6 myoglobin solved with single pulse free electron laser data
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d4pnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pnja_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d4pnja_:

Click to download the PDB-style file with coordinates for d4pnja_.
(The format of our PDB-style files is described here.)

Timeline for d4pnja_: