Lineage for d4poka_ (4pok A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602752Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)
  8. 1602948Domain d4poka_: 4pok A: [260745]
    automated match to d2xbia_
    complexed with com

Details for d4poka_

PDB Entry: 4pok (more details), 2.52 Å

PDB Description: crystal structures of thioredoxin with mesna at 2.5a resolution
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4poka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4poka_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tmvkqiesktafqkalkaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdv
ddcqdvasecevkcmptfqffkkgqkvgefsgankkkleatinklv

SCOPe Domain Coordinates for d4poka_:

Click to download the PDB-style file with coordinates for d4poka_.
(The format of our PDB-style files is described here.)

Timeline for d4poka_: