Lineage for d4p8oa_ (4p8o A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213716Species Staphylococcus aureus [TaxId:703339] [260729] (1 PDB entry)
  8. 2213717Domain d4p8oa_: 4p8o A: [260730]
    automated match to d3ttzb_
    complexed with 883

Details for d4p8oa_

PDB Entry: 4p8o (more details), 2.4 Å

PDB Description: s. aureus gyrase bound to an aminobenzimidazole urea inhibitor
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4p8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p8oa_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 703339]}
gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
yhye

SCOPe Domain Coordinates for d4p8oa_:

Click to download the PDB-style file with coordinates for d4p8oa_.
(The format of our PDB-style files is described here.)

Timeline for d4p8oa_: