SCOPe 2.05: Domain d4p8oa_: 4p8o A:

Lineage for d4p8oa_ (4p8o A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:703339] [260729] (1 PDB entry)

8. Domain d4p8oa_: 4p8o A: [260730]
   automated match to d3ttzb_
   complexed with 883

Details for d4p8oa_

PDB Entry: 4p8o, 2.4 Å

PDB Description: s. aureus gyrase bound to an aminobenzimidazole urea inhibitor

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4p8oa_:

Sequence; same for both SEQRES and ATOM records:

>d4p8oa_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 703339]}
gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
yhye

Timeline for d4p8oa_:

• d4p8oa_ first appeared in SCOPe 2.04
  
• d4p8oa_ appears in SCOPe 2.06
  
• d4p8oa_ appears in the current release, SCOPe 2.08