Lineage for d4nyta_ (4nyt A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683091Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 1683092Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 1683193Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 1683194Protein automated matches [190726] (1 species)
    not a true protein
  7. 1683195Species Human (Homo sapiens) [TaxId:9606] [187887] (30 PDB entries)
  8. 1683259Domain d4nyta_: 4nyt A: [260712]
    automated match to d2j1gb_
    complexed with act, ca, nag, pc, po4

Details for d4nyta_

PDB Entry: 4nyt (more details), 2.25 Å

PDB Description: l-ficolin complexed to phosphocholine
PDB Compounds: (A:) ficolin-2

SCOPe Domain Sequences for d4nyta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nyta_ d.171.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gprtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdfyrdwa
tykqgfgsrlgefwlgndnihaltaqgtselrtdlvdfednyqfakyrsfkvadeaekyn
lvlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchtsnlngryl
rgthgsfanginwksgkgynysykvsemkvrp

SCOPe Domain Coordinates for d4nyta_:

Click to download the PDB-style file with coordinates for d4nyta_.
(The format of our PDB-style files is described here.)

Timeline for d4nyta_: