SCOPe 2.05: Domain d4nddb_: 4ndd B:

Lineage for d4nddb_ (4ndd B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (27 species)
   not a true protein

7. Species Doryteuthis pealeii [TaxId:1051067] [260698] (4 PDB entries)

8. Domain d4nddb_: 4ndd B: [260699]
   automated match to d2ccma_
   complexed with ca; mutant

Details for d4nddb_

PDB Entry: 4ndd, 2.9 Å

PDB Description: x-ray structure of a double mutant of calexcitin - a neuronal calcium- signalling protein

PDB Compounds: (B:) calexcitin

SCOPe Domain Sequences for d4nddb_:

Sequence; same for both SEQRES and ATOM records:

>d4nddb_ a.39.1.0 (B:) automated matches {Doryteuthis pealeii [TaxId: 1051067]}
qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearadlkl
iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
lfgdlkl

Timeline for d4nddb_:

• d4nddb_ first appeared in SCOPe 2.04
  
• d4nddb_ appears in SCOPe 2.06
  
• d4nddb_ appears in the current release, SCOPe 2.08