SCOPe 2.06: Domain d4nbsa3: 4nbs A:321-415

Lineage for d4nbsa3 (4nbs A:321-415)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (16 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [255783] (5 PDB entries)

8. Domain d4nbsa3: 4nbs A:321-415 [260696]
   Other proteins in same PDB: d4nbsa1, d4nbsa2
   automated match to d2qn6a2
   protein/RNA complex; complexed with fmt, gcp, mg, na

Details for d4nbsa3

PDB Entry: 4nbs, 2.31 Å

PDB Description: The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4nbsa3:

Sequence; same for both SEQRES and ATOM records:

>d4nbsa3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Timeline for d4nbsa3:

• d4nbsa3 first appeared in SCOPe 2.04
  
• d4nbsa3 appears in SCOPe 2.05
  
• d4nbsa3 appears in the current release, SCOPe 2.07