Lineage for d4nbsa3 (4nbs A:321-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794039Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries)
  8. 2794041Domain d4nbsa3: 4nbs A:321-415 [260696]
    Other proteins in same PDB: d4nbsa1, d4nbsa2
    automated match to d2qn6a2
    protein/RNA complex; complexed with fmt, gcp, mg, na

Details for d4nbsa3

PDB Entry: 4nbs (more details), 2.31 Å

PDB Description: The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4nbsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbsa3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d4nbsa3:

Click to download the PDB-style file with coordinates for d4nbsa3.
(The format of our PDB-style files is described here.)

Timeline for d4nbsa3: