Lineage for d4nbsa2 (4nbs A:207-320)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. 1544395Species Sulfolobus solfataricus [TaxId:2287] [255782] (3 PDB entries)
  8. 1544397Domain d4nbsa2: 4nbs A:207-320 [260695]
    Other proteins in same PDB: d4nbsa1, d4nbsa3
    automated match to d2qn6a1
    protein/RNA complex; complexed with fmt, gcp, mg, na

Details for d4nbsa2

PDB Entry: 4nbs (more details), 2.31 Å

PDB Description: The structure of aIF2gamma subunit H20F from archaeon Sulfolobus solfataricus complexed with GDPCP
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4nbsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbsa2 b.43.3.0 (A:207-320) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d4nbsa2:

Click to download the PDB-style file with coordinates for d4nbsa2.
(The format of our PDB-style files is described here.)

Timeline for d4nbsa2: