Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein automated matches [190335] (3 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [259200] (1 PDB entry) |
Domain d4mjsk_: 4mjs K: [260685] automated match to d1wmha_ complexed with edo |
PDB Entry: 4mjs (more details), 2.5 Å
SCOPe Domain Sequences for d4mjsk_:
Sequence, based on SEQRES records: (download)
>d4mjsk_ d.15.2.2 (K:) automated matches {Rattus norvegicus [TaxId: 10116]} phmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctvs sqmeleeafrlacqgrdevliihvfpsip
>d4mjsk_ d.15.2.2 (K:) automated matches {Rattus norvegicus [TaxId: 10116]} phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss qmeleeafrlacqgrdevliihvfpsip
Timeline for d4mjsk_: