Lineage for d4mjsk_ (4mjs K:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638613Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1638629Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1638679Protein automated matches [190335] (3 species)
    not a true protein
  7. 1638687Species Rattus norvegicus [TaxId:10116] [259200] (1 PDB entry)
  8. 1638689Domain d4mjsk_: 4mjs K: [260685]
    automated match to d1wmha_
    complexed with edo

Details for d4mjsk_

PDB Entry: 4mjs (more details), 2.5 Å

PDB Description: crystal structure of a PB1 complex
PDB Compounds: (K:) Protein kinase C zeta type

SCOPe Domain Sequences for d4mjsk_:

Sequence, based on SEQRES records: (download)

>d4mjsk_ d.15.2.2 (K:) automated matches {Rattus norvegicus [TaxId: 10116]}
phmrvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctvs
sqmeleeafrlacqgrdevliihvfpsip

Sequence, based on observed residues (ATOM records): (download)

>d4mjsk_ d.15.2.2 (K:) automated matches {Rattus norvegicus [TaxId: 10116]}
phmrvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvss
qmeleeafrlacqgrdevliihvfpsip

SCOPe Domain Coordinates for d4mjsk_:

Click to download the PDB-style file with coordinates for d4mjsk_.
(The format of our PDB-style files is described here.)

Timeline for d4mjsk_: