SCOPe 2.06: Domain d1eq9a_: 1eq9 A:

Lineage for d1eq9a_ (1eq9 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Red fire ant (Solenopsis invicta) [TaxId:13686] [50524] (1 PDB entry)

8. Domain d1eq9a_: 1eq9 A: [26068]
   complexed with pms

Details for d1eq9a_

PDB Entry: 1eq9, 1.7 Å

PDB Description: crystal structure of fire ant chymotrypsin complexed to pmsf

PDB Compounds: (A:) Chymotrypsin

SCOPe Domain Sequences for d1eq9a_:

Sequence; same for both SEQRES and ATOM records:

>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]}
ivggkdapvgkypyqvslrlsgshrcgasildnnnvltaahcvdglsnlnrlkvhvgtny
lsesgdvydvedavvnknyddfllrndvalvhltnpikfndlvqpiklstndedlesnpc
tltgwgstrlggntpnalqeielivhpqkqcerdqwrvidshictltkrgegachgdsgg
plvangaqigivsfgspcalgepdvytrvssfvswinanlkk

Timeline for d1eq9a_:

• d1eq9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eq9a_ appears in SCOPe 2.05
  
• d1eq9a_ appears in SCOPe 2.07
  
• d1eq9a_ appears in the current release, SCOPe 2.08