Lineage for d1mtn.2 (1mtn E:,F:,G:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111671Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 111672Species Cow (Bos taurus) [TaxId:9913] [50523] (45 PDB entries)
  8. 111725Domain d1mtn.2: 1mtn E:,F:,G: [26065]
    Other proteins in same PDB: d1mtnd_, d1mtnh_

Details for d1mtn.2

PDB Entry: 1mtn (more details), 2.8 Å

PDB Description: bovine alpha-chymotrypsin:bpti crystallization

SCOP Domain Sequences for d1mtn.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1mtn.2 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOP Domain Coordinates for d1mtn.2:

Click to download the PDB-style file with coordinates for d1mtn.2.
(The format of our PDB-style files is described here.)

Timeline for d1mtn.2: