Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d3wxro_: 3wxr O: [260643] Other proteins in same PDB: d3wxrb_, d3wxrd2, d3wxrf_, d3wxrg2, d3wxrj_, d3wxrp_, d3wxrr2, d3wxrt_, d3wxru2, d3wxrx_ automated match to d1rypa_ mutant |
PDB Entry: 3wxr (more details), 3.15 Å
SCOPe Domain Sequences for d3wxro_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxro_ d.153.1.4 (O:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3wxro_:
View in 3D Domains from other chains: (mouse over for more information) d3wxr1_, d3wxr2_, d3wxra_, d3wxrb_, d3wxrc_, d3wxrd1, d3wxrd2, d3wxre_, d3wxrf_, d3wxrg1, d3wxrg2, d3wxrh_, d3wxri_, d3wxrj_, d3wxrk_, d3wxrl_, d3wxrm_, d3wxrn_, d3wxrp_, d3wxrq_, d3wxrr1, d3wxrr2, d3wxrs_, d3wxrt_, d3wxru1, d3wxru2, d3wxrv_, d3wxrw_, d3wxrx_, d3wxry_, d3wxrz_ |