Lineage for d3wxrk_ (3wxr K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994325Domain d3wxrk_: 3wxr K: [260642]
    Other proteins in same PDB: d3wxrb_, d3wxrd2, d3wxrf_, d3wxrg2, d3wxrj_, d3wxrp_, d3wxrr2, d3wxrt_, d3wxru2, d3wxrx_
    automated match to d4j70j_
    mutant

Details for d3wxrk_

PDB Entry: 3wxr (more details), 3.15 Å

PDB Description: Yeast 20S proteasome with a mutation of alpha7 subunit
PDB Compounds: (K:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d3wxrk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxrk_ d.153.1.4 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
diilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyiq
aniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqidy
lgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgviv
kivdkdgirqvddfqaq

SCOPe Domain Coordinates for d3wxrk_:

Click to download the PDB-style file with coordinates for d3wxrk_.
(The format of our PDB-style files is described here.)

Timeline for d3wxrk_: