SCOPe 2.06: Domain d3wxrb_: 3wxr B:

Lineage for d3wxrb_ (3wxr B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3wxrb_: 3wxr B: [260639]
   Other proteins in same PDB: d3wxr1_, d3wxr2_, d3wxra_, d3wxrc_, d3wxrd_, d3wxre_, d3wxrg1, d3wxrg2, d3wxrh_, d3wxri_, d3wxrk_, d3wxrl_, d3wxrm_, d3wxrn_, d3wxro_, d3wxrq_, d3wxrr_, d3wxrs_, d3wxru1, d3wxru2, d3wxrv_, d3wxrw_, d3wxry_, d3wxrz_
   automated match to d1rypb_
   mutant

Details for d3wxrb_

PDB Entry: 3wxr, 3.15 Å

PDB Description: Yeast 20S proteasome with a mutation of alpha7 subunit

PDB Compounds: (B:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d3wxrb_:

Sequence; same for both SEQRES and ATOM records:

>d3wxrb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetl
skvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqea
tqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwnd
eleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsq
eindrleal

Timeline for d3wxrb_:

• d3wxrb_ first appeared in SCOPe 2.04
  
• d3wxrb_ appears in SCOPe 2.05
  
• d3wxrb_ appears in SCOPe 2.07
  
• d3wxrb_ appears in the current release, SCOPe 2.08