Lineage for d3wwkc_ (3wwk C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682825Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)
  8. 1683019Domain d3wwkc_: 3wwk C: [260624]
    Other proteins in same PDB: d3wwka_, d3wwkd_
    automated match to d2ziba_

Details for d3wwkc_

PDB Entry: 3wwk (more details), 2.98 Å

PDB Description: crystal structure of clec-2 in complex with rhodocytin
PDB Compounds: (C:) C-type lectin domain family 1 member B

SCOPe Domain Sequences for d3wwkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wwkc_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcdtnwryygdscygffrhnltweeskqyctdmnatllkidnrniveyikarthlirwv
glsrqksnevwkwedgsvisenmfefledgkgnmncayfhngkmhptfcenkhylmcerk
ag

SCOPe Domain Coordinates for d3wwkc_:

Click to download the PDB-style file with coordinates for d3wwkc_.
(The format of our PDB-style files is described here.)

Timeline for d3wwkc_: