Lineage for d4wf2a3 (4wf2 A:271-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053586Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2053708Family b.34.1.0: automated matches [254294] (1 protein)
    not a true family
  6. 2053709Protein automated matches [254678] (2 species)
    not a true protein
  7. 2053712Species Escherichia coli [TaxId:83333] [260612] (1 PDB entry)
  8. 2053713Domain d4wf2a3: 4wf2 A:271-320 [260613]
    Other proteins in same PDB: d4wf2a1, d4wf2a2
    automated match to d1biaa2
    complexed with btx

Details for d4wf2a3

PDB Entry: 4wf2 (more details), 2.31 Å

PDB Description: structure of e. coli bira g142a bound to biotinol-5'-amp
PDB Compounds: (A:) Bifunctional ligase/repressor BirA

SCOPe Domain Sequences for d4wf2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wf2a3 b.34.1.0 (A:271-320) automated matches {Escherichia coli [TaxId: 83333]}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislrsae

SCOPe Domain Coordinates for d4wf2a3:

Click to download the PDB-style file with coordinates for d4wf2a3.
(The format of our PDB-style files is described here.)

Timeline for d4wf2a3: